Sra 1
A protein involved in the initiation of actin polymerization
Fact Sheet Cat. No. 309 011
| Monoclonal mouse antibody | |
|---|---|
|
Cat. No. 309 011 IgG, unlabeled |
100 µg purified IgG, lyophilized. Azide was added before lyophilization. For reconstitution add 100 µl H2O to get a 1mg/ml solution of antibody in PBS. Then aliquot and store at -20°C until use. |
| Applications |
WB: 1 : 100 up to 1 : 2000 (AP staining) blot
IP: yes ICC: no IHC: no ELISA: yes |
| Clone | 30A4 |
| Subtype | IgG1 |
| Immunogen | Synthetic peptide CDWETGHEPFNDPALRGEKDPKSGFDIKVPRRAVGPSS (aa 519 - 556 in mouse Sra 1b) coupled to key-hole limpet hemocyanin via an internal N-terminal cysteine residue. |
| Reactivity | Human, rat, mouse; other species not tested yet. |
| Specificity | Specific for Sra 1. |
