Complexin 1,2

Nerve-terminal syntaxin binding proteins

Fact Sheet

Polyclonal rabbit antibody 1 against complexin 1,2 (synaphin 2,1); C-terminus
Cat. No. 122 002 crude antiserum	200 µl antiserum, lyophilized. For reconstitution add 200 µl H₂O, then aliquot and store at -20°C until use.
Applications	WB: 1 : 1000 up to 1 : 10000 (AP staining) blot IP: yes ICC: 1 : 1000 image IHC: yes (see remarks) image
Immunogen	Synthetic peptide KYLPGPLQDMFKK (aa 122 - 134 in human) coupled to key-hole limpet hemocyanin via an added N-terminal cysteine residue.
Reactivity	Human, cow, rat, mouse, electric ray.
Specificity	Recognizes complexin 1 and 2.
Remarks	Works well with paraffin embedded tissues.

Control peptide for antibody 1
Cat. No. 122-0P	100 µg lyophilized peptide. For reconstitution add 100 µl H₂O to get a 1mg/ml solution in PBS. Then aliquot and store at -20°C until use. Control peptides should also be stored at -20°C when still lyophilized!
Recommended dilution	Optimal concentrations should be determined by the end-user.
Remarks	This control peptide consists of the synthetic peptide (KYLPGPLQDMFKK) that has been used for immunization. It has been tested in preadsorption experiments and blocks efficiently and specifically the corresponding signal in Western blots. The amount of peptide needed for efficient blocking depends on the titer and on the affinity of the antibody to the antigen.

Polyclonal rabbit antibody 2 against complexin 1,2 (synaphin 2,1); SNARE binding domain
Cat. No. 122 102 crude antiserum	200 µl antiserum, lyophilized. For reconstitution add 200 µl H₂O, then aliquot and store at -20°C until use.
Applications	WB: 1 : 1000 up to 1 : 20000 (AP staining) blot IP: yes (see remarks) ICC: 1 : 200 up to 1 : 500 IHC: yes
Immunogen	Synthetic peptide EEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAE (aa 45 - 81 in complexin 2) coupled to key-hole limpet hemocyanin via an added N-terminal cysteine residue.
Reactivity	Human, rat, mouse, guinea pig, cow.
Specificity	Recognizes complexin 1 and 2.
Remarks	IP: Co-immunoprecipitates the SNARE complex. Immunogen is located inside the mapped binding domain of complexin 2 to the SNARE complex (aa 41 - 91).