Complexins

Nerve-terminal syntaxin binding proteins

Fact Sheet

Polyclonal rabbit antibody 1 against complexin 1,2 (synaphin 2,1); C-terminus
complexin 1, 2 complexin 3 complexin 4
Cat. No. 122 002 crude antiserum	200 µl antiserum, lyophilized. For reconstitution add 200 µl H₂O, then aliquot and store at -20°C until use.
Applications	WB: 1 : 1000 up to 1 : 10000 (AP staining) blot IP: yes ICC: 1 : 1000 image IHC: yes, works well with paraffin embedded tissues
Immunogen	Synthetic peptide KYLPGPLQDMFKK (aa 122 - 134 in human) coupled to key-hole limpet hemocyanin via an added N-terminal cysteine residue.
Reactivity	Human, cow, rat, mouse, electric ray.
Specificity	Recognizes complexin 1 and 2.

Control peptide for antibody 1
Cat. No. 122-0P	100 µg lyophilized peptide. For reconstitution add 100 µl H₂O to get a 1mg/ml solution in PBS. Then aliquot and store at -20°C until use. Control peptides should also be stored at -20°C when still lyophilized!
Recommended dilution	Optimal concentrations should be determined by the end-user.
Remarks	This control peptide consists of the synthetic peptide (KYLPGPLQDMFKK) that has been used for immunization. It has been tested in preadsorption experiments and blocks efficiently and specifically the corresponding signal in Western blots. The amount of peptide needed for efficient blocking depends on the titer and on the affinity of the antibody to the antigen.

Polyclonal rabbit antibody 2 against complexin 1,2 (synaphin 2,1); SNARE binding domain
Cat. No. 122 102 crude antiserum	200 µl antiserum, lyophilized. For reconstitution add 200 µl H₂O, then aliquot and store at -20°C until use.
Applications	WB: 1 : 1000 up to 1 : 20000 (AP staining) blot IP: yes (see remarks) ICC: 1 : 200 up to 1 : 500 IHC: yes
Immunogen	Synthetic peptide EEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAE (aa 45 - 81 in complexin 2) coupled to key-hole limpet hemocyanin via an added N-terminal cysteine residue.
Reactivity	Human, rat, mouse, cow.
Specificity	Recognizes complexin 1 and 2.
Remarks	IP: Co-immunoprecipitates the SNARE complex. Immunogen is located inside the mapped binding domain of complexin 2 to the SNARE complex (aa 41 - 91).

Monoclonal mouse antibody against complexin 3
Cat. No. 122 311 IgG, unlabeled	100 µg purified IgG, lyophilized. For reconstitution add 100 µl H2O to get a 1mg/ml solution of antibody in PBS. Then aliquot and store at -20°C until use.
Applications	WB: 1 : 1000 (ECL detection) blot IP: not tested yet ICC: not tested yet IHC: 1 : 500
Clone	294C2
Subtype	IgG1
Immunogen	Recombinant full length protein of mouse complexin 3.
Reactivity	Rat, mouse; other species not tested yet.
Specificity	Specific for complexin 3, no cross reaction to other complexins.

Polyclonal rabbit antibody against complexin 3
Cat. No. 122 302 crude antiserum	200 µl antiserum, lyophilized. For reconstitution add 200 µl H₂O, then aliquot and store at -20°C until use.
Applications	WB: 1 : 1000 (AP staining) blot IP: not tested yet ICC: not tested yet IHC: yes
Immunogen	Recombinant full length protein of mouse complexin 3.
Reactivity	Rat, mouse; other species not tested yet.
Specificity	Specific for complexin 3, no cross reaction to other complexins.

Monoclonal mouse antibody against complexin 4
Cat. No. 122 411 IgG, unlabeled	100 µg purified IgG, lyophilized. For reconstitution add 100 µl H2O to get a 1mg/ml solution of antibody in PBS. Then aliquot and store at -20°C until use.
Applications	WB: 1 : 1000 (ECL detection) blot IP: not tested yet ICC: not tested yet IHC: 1 : 1000
Clone	171H8
Subtype	IgG1
Immunogen	Recombinant full length protein of mouse complexin 4.
Reactivity	Rat, mouse; other species not tested yet.
Specificity	Specific for complexin 4, no cross reaction to other complexins.

Polyclonal rabbit antibody against complexin 4
Cat. No. 122 402 crude antiserum	200 µl antiserum, lyophilized. For reconstitution add 200 µl H₂O, then aliquot and store at -20°C until use.
Applications	WB: 1 : 1000 (AP staining) blot IP: not tested yet ICC: not tested yet IHC: yes
Immunogen	Recombinant full length protein of mouse complexin 4.
Reactivity	Rat, mouse; other species not tested yet.
Specificity	Specific for complexin 4, no cross reaction to other complexins.

All Products

Antibodies against

Miscellaneous Antibodies

Tissue Lysates

Chemical Reagents