Complexin 1,2
Nerve-terminal syntaxin binding proteins
Fact Sheet Cat. No. 122 102
| Polyclonal rabbit antibody 2; SNARE binding domain | |
|---|---|
|
Cat. No. 122 102 crude antiserum |
200 µl antiserum, lyophilized. For reconstitution add 200 µl H2O, then aliquot and store at -20°C until use. |
| Applications |
WB: 1 : 1000 up to 1 : 20000 (AP staining) blot
IP: yes (see remarks) ICC: 1 : 200 up to 1 : 500 IHC: yes |
| Immunogen | Synthetic peptide EEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAE (aa 45 - 81 in complexin 2) coupled to key-hole limpet hemocyanin via an added N-terminal cysteine residue. |
| Reactivity | Human, rat, mouse, guinea pig, cow. |
| Specificity | Recognizes complexin 1 and 2. |
| Remarks |
|
